PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010936122.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family TALE
Protein Properties Length: 355aa    MW: 39307.9 Da    PI: 7.791
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010936122.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.2e-101381751954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_010936122.1 138 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 175
                     665559******************************88 PP

2BELL95.64.5e-3116691972
            BELL 19 VdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                    Vd+rY++y++q+q+v++sF+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  XP_010936122.1 16 VDRRYNHYCDQMQMVVNSFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAVQL 69
                    9**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.1E-9167IPR006563POX domain
PfamPF075261.0E-271666IPR006563POX domain
PROSITE profilePS5007112.568116179IPR001356Homeobox domain
CDDcd000863.71E-13119180No hitNo description
SMARTSM003891.2E-9119183IPR001356Homeobox domain
SuperFamilySSF466891.11E-17120186IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-29122185IPR009057Homeodomain-like
PfamPF059201.4E-18136175IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MVRQHHMQKR QADRPVDRRY NHYCDQMQMV VNSFDSVMGF GAATPYTALA QKAMSRHFRC  60
LKDAIAVQLK QTCELLGDKE AGSGSGLTKG ETPRLRFIDQ TLRQQRAFHQ MGMMEQEAWR  120
PQRGLPERSV NILRAWLFEH FLHPYPSDAD KHLLARQTGL SRNQVSNWFI NARVRLWKPM  180
VEEMYQQEAK EDSEERETSE AGHQEAQSPA QQQQQQQHQQ PQGQKPDTNA PSEMDPSLAP  240
PSTSRHHHHL LATSSSSADN PPPAAVGHPS TGGAGGGGDN APLVGIDAPE LCRPDVHMGP  300
TNDMYRYGAT SAATLGPAAQ MRFGTAGDVS LTLGLRHAGG NAAEKGRFSV RDFSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-17125183563Homeobox protein Meis2
3k2a_B6e-17125183563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936122.10.0PREDICTED: BEL1-like homeodomain protein 4 isoform X1
SwissprotQ94KL51e-119BLH4_ARATH; BEL1-like homeodomain protein 4
SwissprotQ9SW801e-118BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLM0SNY21e-152M0SNY2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P14670_0011e-151(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-113BEL1-like homeodomain 2